PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr2P10040_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 292aa    MW: 32463.4 Da    PI: 5.9402
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr2P10040_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.81.8e-18130184256
                            T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            rk+ +++++q  +Lee F+k+++++ +++  LA++l+L  rqV vWFqNrRa+ k
  GSMUA_Achr2P10040_001 130 RKKLRLSTDQSAVLEESFKKHSTLNPKQKLALAEQLNLRPRQVEVWFQNRRARTK 184
                            788899***********************************************98 PP

2HD-ZIP_I/II1261.7e-40130219191
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            +kk+rls++q+++LEesF+++++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l+een+rL+kev+eLr
  GSMUA_Achr2P10040_001 130 RKKLRLSTDQSAVLEESFKKHSTLNPKQKLALAEQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCESLTEENRRLQKEVQELR 217
                            69*************************************************************************************9 PP

            HD-ZIP_I/II  89 eel 91 
                             +l
  GSMUA_Achr2P10040_001 218 -AL 219
                            .55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046184.2E-192102IPR006712HD-ZIP protein, N-terminal
PROSITE profilePS5007117.265126186IPR001356Homeobox domain
SMARTSM003891.8E-16128190IPR001356Homeobox domain
SuperFamilySSF466894.19E-18128194IPR009057Homeodomain-like
PfamPF000467.4E-16130184IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.2E-17130184IPR009057Homeodomain-like
CDDcd000865.34E-16130187No hitNo description
PROSITE patternPS000270161184IPR017970Homeobox, conserved site
PfamPF021835.6E-11186220IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.1E-26186229IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009641Biological Processshade avoidance
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009826Biological Processunidimensional cell growth
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MMMEKEDLAL SLGLNTSTNY FPPSLSLMAP SSSPSWPMSS HRLLGPSAGE TRPLLTMIDV  60
NRAPSVAATA GKVSEEEEEE EEGGASSLNS AVSSVGGKRA ERHALAGDDH DAERACFRVV  120
SDEEDGEGSR KKLRLSTDQS AVLEESFKKH STLNPKQKLA LAEQLNLRPR QVEVWFQNRR  180
ARTKLKQTEV DCEFLKKCCE SLTEENRRLQ KEVQELRALK LSPQLYMQMT PPTTLTMCPS  240
CERVSNPATT SSPANPQPSE HHQYSNHDRQ TAASWAPFPL EPLFLDSIPQ RS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1128134SRKKLRL
2178186RRARTKLKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00550DAPTransfer from AT5G47370Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009389298.10.0PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotP466019e-88HAT2_ARATH; Homeobox-leucine zipper protein HAT2
TrEMBLM0S6P50.0M0S6P5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P10040_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25873889
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.13e-84homeobox protein 2